PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF093300030CFD_t1
Common NameTRAES_3BF093300030CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 268aa    MW: 29087.1 Da    PI: 6.2883
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF093300030CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353.1e-11143191452
                              XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                               kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  ++  l
  TRAES3BF093300030CFD_t1 143 PKRVKRILANRQSAQRSRVRKLQYISELERCVTTLQNEVSVLSPRVAFL 191
                              5999**********************************88887666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-14140204IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.53142194IPR004827Basic-leucine zipper domain
PfamPF001701.7E-9144189IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.7E-13144198No hitNo description
SuperFamilySSF579595.14E-11144198No hitNo description
CDDcd147032.74E-26145196No hitNo description
PROSITE patternPS000360147162IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MAQLPPKIPT AATGAHHWPG AGVEHHGHGP VAVWADEFAE FAAARRGAHR RSLSDSVAFV  60
EMAPGGCGGA GDFDRLDDDQ LMSMFPDEGG STAPGSENGT SDSDGDKHGK DRYDDGQHDD  120
ANPEEPGPGQ ATPTSSTETI RDPKRVKRIL ANRQSAQRSR VRKLQYISEL ERCVTTLQNE  180
VSVLSPRVAF LDQQRTILTV GNSHLKQRIA ALAQDKLFKD AHQEALKEEI ERLRQVYQQQ  240
NLRMSSGAGA ASDHGGPPPV RAEKELMS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569840.11e-134PREDICTED: basic leucine zipper 6-like
SwissprotQ5JMK61e-128BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLW5CSH20.0W5CSH2_WHEAT; Uncharacterized protein
STRINGMLOC_66252.11e-169(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-67bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]